Primary Antibodies

Jump to Filters
View as table Download
MDA5 (IFIH1) Rabbit Polyclonal Antibody
TA306392

USD 430.00

5 Days

Rabbit Polyclonal MDA5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen MDA5 antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human MDA5.
MDA5 (IFIH1) Rabbit Polyclonal Antibody
TA306393

USD 430.00

5 Days

Rabbit Polyclonal MDA5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen MDA5 antibody was raised against a 16 amino acid peptide from near the center of human MDA5.
MDA5 (IFIH1) Goat Polyclonal Antibody
TA302870

USD 375.00

5 Days

Goat Polyclonal Antibody against IFIH1 (MDA5)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence SNGYSTDENFRYL-C, from the N Terminus of the protein sequence according to NP_071451.2.
MDA5 (IFIH1) Rabbit Polyclonal Antibody
TA341618

USD 375.00

5 Days

Rabbit Polyclonal Anti-IFIH1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IFIH1 antibody: synthetic peptide directed towards the middle region of human IFIH1. Synthetic peptide located within the following region: QINDTIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGDDEYCDGDEDED