Primary Antibodies

Jump to Filters
View as table Download
AK6 Rabbit Polyclonal Antibody
TA349030

USD 484.00

5 Days

Rabbit Polyclonal Anti-TERF2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TERF2 antibody was raised against a 17 amino acid peptide near the amino terminus of human TERF2.
AK6 Rabbit Polyclonal Antibody
TA336079

USD 375.00

5 Days

Rabbit Polyclonal Anti-TAF9 Antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TAF9 Antibody: synthetic peptide directed towards the N terminal of human TAF9. Synthetic peptide located within the following region: GLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVD
AK6 Rabbit Polyclonal Antibody
TA366383

USD 380.00

4 Weeks

AK6 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human AK6