Primary Antibodies

Jump to Filters
View as table Download
IMPDH1 Rabbit Polyclonal Antibody
TA335348

USD 375.00

5 Days

Rabbit Polyclonal Anti-IMPDH1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IMPDH1 Antibody: synthetic peptide directed towards the middle region of human IMPDH1. Synthetic peptide located within the following region: KKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTRE
IMPDH1 Rabbit Polyclonal Antibody
TA351292

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-IMPDH1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human IMPDH1
IMPDH1 Rabbit Polyclonal Antibody
TA367100

USD 380.00

4 Weeks

IMPDH1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human IMPDH1