Primary Antibodies

Jump to Filters
View as table Download
ADAMTS1 Rabbit Polyclonal Antibody
TA317919

USD 425.00

In Stock

ADAMTS1 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit
Conjugation Unconjugated
Immunogen ADAMTS1 antibody was raised against synthetic 18 amino acid peptide from internal region of human ADAMTS1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rabbit, Horse, Pig (100%); Bat, Bovine, Panda, Xenopus (94%); Mouse, Dog, Hamster, Elephant, Opossum (89%); Rat, Sheep, Turkey, Chicken (83%).
HSD17B11 Rabbit Polyclonal Antibody
TA343846

USD 475.00

5 Days

Rabbit Polyclonal Anti-HSD17B11 Antibody

Applications IHC
Reactivities Monkey
Conjugation Unconjugated
Immunogen The immunogen for anti-HSD17B11 antibody: synthetic peptide directed towards the N terminal of human HSD17B11. Synthetic peptide located within the following region: TGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLG
Factor IX (F9) Rabbit Polyclonal Antibody
TA308875

USD 415.00

5 Days

Rabbit polyclonal antibody to Factor IX (coagulation factor IX)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 217 and 453 of Factor IX (Uniprot ID#P00740)
FAM3C Rabbit Polyclonal Antibody
TA316733

USD 425.00

In Stock

ILEI / FAM3C Rabbit Polyclonal (aa40-80) Antibody

Applications IHC
Reactivities Bovine, Chimpanzee, Chicken, Human, Monkey, Mouse, Opossum, Rat, Dog, Pufferfish
Conjugation Unconjugated
Immunogen ILEI / FAM3C antibody was raised against synthetic peptide from human FAM3C.
IGFBP5 Rabbit Polyclonal Antibody
TA316916

USD 425.00

2 Weeks

Anti-IGFBP-5 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Dog, Gorilla, Goat, Hamster, Horse, Human, Monkey, Pig, Rabbit
Conjugation Unconjugated
Immunogen IGFBP5 antibody was raised against human IGFBP5 amino acids 192-206 (CRRHMEASLQELKAS). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Dog, Bat, Bovine, Goat, Hamster, Elephant, Panda, Horse, Rabbit, Pig (100%); Mouse, Rat, Opossum, Chicken (93%); Marmoset (87%).
WNT2B Rabbit Polyclonal Antibody
TA317518

USD 425.00

In Stock

WNT2B Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen WNT2B antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT2B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Panda, Horse, Rabbit, Pig (100%); Elephant (94%); Opossum, Platypus (88%).
Prealbumin (TTR) Rabbit Polyclonal Antibody
TA324860

USD 450.00

5 Days

Rabbit polyclonal TTR Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TTR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 71-98 amino acids from the C-terminal region of human TTR.
MCP1 (CCL2) Rabbit Polyclonal Antibody
TA324861

USD 450.00

5 Days

Rabbit polyclonal CCL2 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CCL2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the C-terminal region of human CCL2.
IL4 Rabbit Polyclonal Antibody
TA324803

USD 450.00

5 Days

Rabbit polyclonal IL4 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This L4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 122-150 amino acids from the C-terminal region of human L4.
WNT7A Rabbit Polyclonal Antibody
TA317522

USD 425.00

5 Days

WNT7A Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Chimpanzee, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Xenopus, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen WNT7A antibody was raised against synthetic 12 amino acid peptide from internal region of human WNT7A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Xenopus (100%); Seabass (92%); Stickleback, Pufferfish, Zebrafish (83%).
TLL2 Rabbit Polyclonal Antibody
TA317423

USD 425.00

5 Days

TLL2 Rabbit Polyclonal (CUB 2 Domain) Antibody

Applications IHC
Reactivities Bat, Gibbon, Dog, Human, Monkey, Pig, Rat
Conjugation Unconjugated
Immunogen TLL2 antibody was raised against synthetic 13 amino acid peptide from CUB 2 domain human TLL2. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Galago, Marmoset, Rat, Dog, Bat, Pig (100%); Gorilla, Hamster, Panda (92%); Mouse, Horse (85%).
WNT6 Rabbit Polyclonal Antibody
TA317519

USD 425.00

5 Days

WNT6 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Rabbit
Conjugation Unconjugated
Immunogen WNT6 antibody was raised against synthetic 18 amino acid peptide from internal region of human WNT6. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Elephant, Bovine, Dog, Bat, Horse, Rabbit, Opossum (100%); Marmoset, Mouse, Rat, Hamster, Platypus (94%); Turkey, Chicken (83%).
WNT8A Rabbit Polyclonal Antibody
TA317524

USD 425.00

5 Days

WNT8A Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Gibbon, Gorilla, Horse, Human, Monkey
Conjugation Unconjugated
Immunogen WNT8A antibody was raised against synthetic 14 amino acid peptide from internal region of human WNT8A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bat, Elephant, Panda, Horse (100%); Bovine, Dog (93%); Rabbit (86%).
WNT8B Rabbit Polyclonal Antibody
TA317525

USD 425.00

5 Days

WNT8B / Wnt 8b Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human
Conjugation Unconjugated
Immunogen WNT8B / Wnt 8b antibody was raised against synthetic 17 amino acid peptide from C-Terminus of human WNT8B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Panda (100%); Marmoset, Dog, Bat, Horse, Rabbit (94%); Bovine (88%); Elephant (82%).
WNT9A Rabbit Polyclonal Antibody
TA317528

USD 425.00

5 Days

WNT14 / WNT9A Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human, Monkey
Conjugation Unconjugated
Immunogen WNT14 / WNT9A antibody was raised against synthetic 16 amino acid peptide from N-Terminus of human WNT9A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Panda (100%); Mouse, Rat, Bovine, Bat, Rabbit (94%).
WNT10A Rabbit Polyclonal Antibody
TA317685

USD 425.00

5 Days

WNT10A Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Dog, Gorilla, Human, Monkey
Conjugation Unconjugated
Immunogen WNT10A antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT10A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Dog, Bovine (100%); Mouse, Rat, Hamster, Bat, Rabbit (94%); Opossum (81%).
WNT9B Rabbit Polyclonal Antibody
TA317687

USD 425.00

5 Days

WNT9B Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rat
Conjugation Unconjugated
Immunogen WNT9B / WNT15 antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT9B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Horse, Pig (100%); Bat, Rabbit (94%); Dog (88%).
WNT10A Rabbit Polyclonal Antibody
TA317690

USD 425.00

5 Days

WNT10A Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Dog, Gorilla, Human, Monkey, Rabbit
Conjugation Unconjugated
Immunogen WNT10A antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT10A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Dog, Bovine, Bat, Elephant, Panda, Rabbit (100%); Rat, Hamster, Opossum (94%).
PLA2G3 Rabbit Polyclonal Antibody
TA317693

USD 425.00

5 Days

PLA2G3 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Gorilla, Human, Monkey, Pig
Conjugation Unconjugated
Immunogen PLA2G3 antibody was raised against synthetic 12 amino acid peptide from internal region of human PLA2G3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Elephant, Panda, Pig (100%); Mouse, Horse, Rabbit (92%); Bat, Dog, Opossum (83%).
ADAMTS1 Rabbit Polyclonal Antibody
TA317920

USD 425.00

5 Days

ADAMTS1 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human, Monkey, Orang-Utan
Conjugation Unconjugated
Immunogen ADAMTS1 antibody was raised against synthetic 17 amino acid peptide from internal region of human ADAMTS1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%); Elephant, Horse (94%); Bat, Pig (88%); Mouse, Rat, Hamster, Rabbit (82%).
WNT11 Rabbit Polyclonal Antibody
TA317956

USD 425.00

5 Days

WNT11 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen WNT11 antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT11. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Bat, Horse, Rabbit, Pig, Turkey, Chicken, Platypus (100%); Opossum, Stickleback (87%); Xenopus, Zebrafish (80%).
WNT4 Rabbit Polyclonal Antibody
TA317957

USD 425.00

5 Days

WNT4 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bovine, Hamster, Human, Monkey, Mouse, Rat, Gorilla, Dog, Pig, Horse
Conjugation Unconjugated
Immunogen WNT4 antibody was raised against synthetic 14 amino acid peptide from internal region of human WNT4. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Horse, Pig (100%); Opossum (86%).
WNT4 Rabbit Polyclonal Antibody
TA317958

USD 425.00

5 Days

WNT4 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bovine, Hamster, Human, Monkey, Mouse, Rat, Gorilla, Dog, Pig, Horse
Conjugation Unconjugated
Immunogen WNT4 antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT4. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Mouse, Rat, Hamster, Panda, Bovine, Dog, Horse, Pig (100%); Elephant (94%); Opossum (88%).