Primary Antibodies

Jump to Filters
View as table Download
ALDH2 Rabbit Polyclonal Antibody
TA327010

USD 275.00

3 Weeks

Rabbit anti-ALDH2 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ALDH2
Aldehyde dehydrogenase 10 (ALDH3A2) Rabbit Polyclonal Antibody
TA590756

USD 409.00

In Stock

Rabbit Polyclonal FALDH Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
UGT (UGT1A9) Rabbit Polyclonal Antibody
TA308133

USD 415.00

In Stock

Rabbit Polyclonal antibody to UGT1A9 (UDP glucuronosyltransferase 1 family, polypeptide A9)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 291 and 530 of UGT1A9 (Uniprot ID#O60656)
UGT (UGT1A9) Rabbit Polyclonal Antibody
TA327128

USD 275.00

3 Weeks

UGT1A9 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human UGT1A9
Aldehyde dehydrogenase 10 (ALDH3A2) Goat Polyclonal Antibody
TA348940

USD 429.00

5 Days

Goat Polyclonal Anti-ALDH3A2 Antibody

Applications IHC
Reactivities Human (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-ALDH3A2 Antibody: Peptide with sequence C-SLKREGANKLRYPP, from the internal region of the protein sequence according to NP_001026976.1; NP_000373.1.
Aldehyde dehydrogenase 10 (ALDH3A2) Rabbit Polyclonal Antibody
TA335228

USD 375.00

5 Days

Rabbit Polyclonal Anti-ALDH3A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the C terminal of human ALDH3A2. Synthetic peptide located within the following region: FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFG
ALDH9A1 Rabbit Polyclonal Antibody
TA323584

USD 345.00

In Stock

Anti-ALDH9A1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 18-32 amino acids of human aldehyde dehydrogenase 9 family, member A1
ALDH9A1 Rabbit Polyclonal Antibody
TA323585

USD 345.00

In Stock

Anti-ALDH9A1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 18-32 amino acids of human aldehyde dehydrogenase 9 family, member A1
Aldehyde dehydrogenase 10 (ALDH3A2) Rabbit Polyclonal Antibody
TA350577

USD 345.00

In Stock

Rabbit Polyclonal Anti-ALDH3A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ALDH3A2
UGT (UGT2B4) Rabbit Polyclonal Antibody
TA350581

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-UGT2B4 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human UGT2B4