Primary Antibodies

View as table Download

Dopamine Receptor D3 / DRD3 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Chimpanzee, Gorilla, Human, Monkey
Conjugation Unconjugated
Immunogen DRD3 / Dopamine Receptor D3 antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human DRD3 / Dopamine Receptor D3. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey, Marmoset (100%); Gibbon, Mouse, Dog, Bovine, Bat, Hamster, Elephant, Panda, Horse, Rabbit (94%); Rat, Pig, Opossum (88%).

GPR183 / EBI2 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gorilla, Human
Conjugation Unconjugated
Immunogen GPR183 / EBI2 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human GPR183 / EBI2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig (93%); Opossum, Platypus, Catfish, Zebrafish (80%).

TRPV2 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gorilla, Horse, Human, Monkey, Pig
Conjugation Unconjugated
Immunogen VRL1 / TRPV2 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human TRPV2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Horse, Pig (100%); Gibbon, Bovine, Hamster, Panda, Rabbit (93%); Mouse, Dog (87%); Elephant (80%).

CHRM3 / M3 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human, Monkey, Orang-Utan
Conjugation Unconjugated
Immunogen CHRM3 / M3 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human CHRM3 / M3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Chimpanzee, Mouse, Rat, Sheep, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (95%); Opossum, Turkey, Chicken, Lizard (89%).

Optineurin Rabbit Polyclonal (aa575-591) Antibody

Applications IHC
Reactivities Bat, Gibbon, Dog, Gorilla, Horse, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat
Conjugation Unconjugated
Immunogen OPTN / Optineurin antibody was raised against synthetic peptide corresponding to aa 559-575 (GEVLPDIDTLQIHVMDC) of human, mouse and rat optineurin

Rabbit polyclonal HSP90B1 Antibody (N-term)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Hamster
Conjugation Unconjugated
Immunogen This HSP90B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 16-43 amino acids from the N-terminal region of human HSP90B1.

Rabbit Polyclonal Antibody against HMGB1 - Oligodendrocyte Marker

Applications IHC, WB
Reactivities Human, Mouse, Dog, Bovine, Hamster, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human HMGB1 protein sequence (between residues 100-200). [UniProt #P09429]

CALCRL / CRLR Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Dog, Xenopus, Gorilla, Goat, Hamster, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit, Rat
Conjugation Unconjugated
Immunogen CALCRL / CGRP Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rat, Goat, Hamster, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Xenopus (100%); Mouse, Elephant, Bat, Guinea pig, Stickleback, Pufferfish, Zebrafish (94%); Turkey, Chicken (81%).

Anti-Hepsin Rabbit Polyclonal Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Dog, Gorilla, Human, Monkey, Orang-Utan, Rabbit
Conjugation Unconjugated
Immunogen HPN / TMPRSS1 / Hepsin antibody was raised against human hepsin amino acids 241-260 (GGYLPFRDPNSEENSNDIAL). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Bovine, Dog, Bat, Panda, Rabbit (100%); Opossum (95%); Hamster, Horse (90%); Mouse, Rat (85%); Xenopus (80%).

Anti-IGFBP-5 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Dog, Gorilla, Goat, Hamster, Horse, Human, Monkey, Pig, Rabbit
Conjugation Unconjugated
Immunogen IGFBP5 antibody was raised against human IGFBP5 amino acids 192-206 (CRRHMEASLQELKAS). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Dog, Bat, Bovine, Goat, Hamster, Elephant, Panda, Horse, Rabbit, Pig (100%); Mouse, Rat, Opossum, Chicken (93%); Marmoset (87%).

INPP5J / PIB5PA Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Bat, Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen INPP5J / PIB5PA antibody was raised against synthetic 18 amino acid peptide from near C-terminus of human INPP5J / PIB5PA. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig (100%); Platypus (83%).

PGES / PTGES Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human, Monkey, Mouse, Pig, Rabbit, Rat
Conjugation Unconjugated
Immunogen PGES / PTGES antibody was raised against synthetic 16 amino acid peptide from N-Terminus of human PTGES. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Elephant, Rabbit, Pig (100%); Hamster, Bovine (94%); Dog, Horse, Turkey, Chicken (88%); Pike (81%).

Rabbit polyclonal PCNA Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PCNA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-117 amino acids from the Central region of human PCNA.

Rabbit Polyclonal Anti-KCNQ1 Antibody

Applications IHC, WB
Reactivities Hamster, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNQ1 antibody: synthetic peptide directed towards the N terminal of human KCNQ1. Synthetic peptide located within the following region: RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGI

GLG1 / MG160 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Gorilla, Dog, Horse, Gibbon
Conjugation Unconjugated
Immunogen GLG1 / MG160 antibody was raised against synthetic 18 amino acid peptide from internal region of human GLG1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Bat, Bovine, Hamster, Elephant, Panda, Horse, Rabbit, Opossum, Turkey, Chicken, Xenopus, Zebrafish (100%); Stickleback (89%).

GPC4 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Dog, Gorilla, Hamster, Human, Pig
Conjugation Unconjugated
Immunogen GPC4 / Glypican 4 antibody was raised against synthetic 16 amino acid peptide from N-Terminus of human GPC4 / Glypican 4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Hamster, Panda, Dog, Pig (100%); Marmoset, Mouse, Elephant, Bovine, Horse (94%); Rat, Bat, Rabbit (88%).

ITGA3 / CD49c Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Bovine, Gorilla, Human
Conjugation Unconjugated
Immunogen ITGA3 / CD49c antibody was raised against synthetic 18 amino acid peptide from N-terminus of human ITGA3 / CD49c. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Bovine (100%); Marmoset, Mouse, Dog, Bat, Hamster, Elephant, Horse, Opossum (94%); Rabbit (89%).

Rabbit polyclonal HSPD1 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This HSPD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 396-423 amino acids from the C-terminal region of human HSPD1.

Rabbit polyclonal PRDX2 Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This PRDX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 169-198 amino acids from the C-terminal region of human PRDX2.

GRPR Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Dog, Gorilla, Hamster, Human, Monkey, Mouse, Pig, Rat
Conjugation Unconjugated
Immunogen GRPR antibody was raised against synthetic 17 amino acid peptide from 3rd cytoplasmic domain of human GRPR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Bovine, Dog, Bat, Pig (100%); Panda, Rabbit, Opossum (94%); Horse (88%); Turkey, Chicken, Lizard (82%).

FKSG80 / GPR81 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Bat, Dog, Gorilla, Hamster, Human, Monkey, Rabbit, Rat
Conjugation Unconjugated
Immunogen FKSG80 / GPR81 antibody was raised against synthetic 16 amino acid peptide from 2nd extracellular domain of human GPR81. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Rat, Dog, Bat, Hamster, Panda, Rabbit, Opossum (100%); Mouse, Horse, Pig, Platypus (94%); Bovine (88%); Elephant (81%).

HTR6 / 5-HT6 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Chimpanzee, Dog, Gorilla, Hamster, Horse, Human, Monkey, Rat
Conjugation Unconjugated
Immunogen HTR6 / 5-HT6 Receptor antibody was raised against synthetic 17 amino acid peptide from C-terminus of human HTR6 / 5-HT36. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Marmoset, Rat, Hamster, Panda, Dog, Horse (100%); Mouse, Elephant, Bovine, Bat, Rabbit (94%); Stickleback, Pufferfish (88%); Turkey, Chicken, Xenopus, Zebrafish (82%).

KCNMA1 / BK Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Dog, Pig
Conjugation Unconjugated
Immunogen KCNMA1 / BK antibody was raised against synthetic 15 amino acid peptide from internal region of human KCNMA1. Percent identity with other species by BLAST analysis: Human, Monkey, Mouse, Rat, Hamster, Bovine, Dog, Rabbit, Pig, Turkey, Chicken, Xenopus, Seabass, Stickleback, Pufferfish, Zebrafish (100%).

Phosphodiesterase 1c / PDE1C Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Bat, Bovine, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Gorilla, Dog, Horse, Gibbon
Conjugation Unconjugated
Immunogen PDE1C antibody was raised against synthetic 16 amino acid peptide from C-terminus of human PDE1C. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Elephant, Panda, Horse, Rabbit (100%); Opossum (88%).

WNT7A Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Chimpanzee, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Xenopus, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen WNT7A antibody was raised against synthetic 12 amino acid peptide from internal region of human WNT7A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Xenopus (100%); Seabass (92%); Stickleback, Pufferfish, Zebrafish (83%).

GPR137B Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Horse, Human, Monkey, Mouse, Pig, Rabbit, Rat
Conjugation Unconjugated
Immunogen GPR137B antibody was raised against synthetic 16 amino acid peptide from C-terminus of human GPR137B / TM7SF1. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rat, Panda, Horse, Rabbit, Pig, Opossum (100%); Hamster, Elephant, Bovine (94%); Goat, Chicken, Lizard (88%); Dog, Bat, Turkey (81%).

CNR2 / CB2 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Gibbon, Dog, Gorilla, Human, Monkey
Conjugation Unconjugated
Immunogen CNR2 / CB2 antibody was raised against synthetic 20 amino acid peptide from 3rd cytoplasmic domain of human CNR2 / CB2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Dog (100%); Mouse, Rat, Elephant, Panda (95%); Hamster, Bat, Horse (90%); Rabbit (85%).

Alpha 1b / ADRA1B Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rat
Conjugation Unconjugated
Immunogen ADRA1B antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human ADRA1B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Hamster, Elephant, Panda, Horse, Pig, Opossum (100%); Bat (94%); Turkey, Chicken (88%); Platypus (81%).

KCNH2 / HERG Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Dog, Hamster, Horse, Human, Monkey, Mouse, Pig, Rabbit, Rat
Conjugation Unconjugated
Immunogen KCNH2 / HERG antibody was raised against synthetic 16 amino acid peptide from internal region of human KCNH2 / Kv11.1. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Horse, Rabbit, Pig (100%); Bat, Guinea pig (94%).

Rabbit polyclonal Phospho-p53(S20) Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S20 of human p53.
Modifications Phospho-specific

Rabbit Polyclonal Anti-KCNQ2 Antibody

Applications IHC, WB
Reactivities Hamster, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNQ2 antibody: synthetic peptide directed towards the N terminal of human KCNQ2. Synthetic peptide located within the following region: IDIMVLIASIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKL

Dopamine Receptor D3 / DRD3 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Bat, Gibbon, Chimpanzee, Dog, Hamster, Horse, Human, Monkey, Mouse, Pig
Conjugation Unconjugated
Immunogen DRD3 / Dopamine Receptor D3 antibody was raised against synthetic 18 amino acid peptide from 3rd cytoplasmic domain of human DRD3 / Dopamine Receptor D3. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gibbon, Monkey, Marmoset, Mouse, Dog, Bat, Hamster, Panda, Horse, Pig (100%); Rat, Rabbit (94%); Elephant (89%).

ERP44 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Bat, Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen ERP44 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human ERP44 / TXNDC4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Bat, Bovine, Hamster, Elephant, Panda, Horse, Rabbit, Pig, Opossum, Platypus (100%); Zebrafish (89%); Turkey, Chicken (83%).

ESRRB / ERR-Beta Rabbit Polyclonal (Ligand-binding Domain) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Pig, Rabbit
Conjugation Unconjugated
Immunogen ESRRB / ERR Beta antibody was raised against synthetic 15 amino acid peptide from ligand-binding domain of human ESRRB. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Hamster, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum (100%); Mouse, Rat, Elephant, Turkey, Chicken, Lizard (93%); Bat (87%); Stickleback, Medaka, Pufferfish, Zebrafish (80%).

GLG1 / MG160 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Chimpanzee, Guinea Pig, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen GLG1 / MG160 antibody was raised against synthetic 18 amino acid peptide from internal region of human GLG1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig, Guinea pig (100%); Galago, Elephant, Platypus, Medaka (94%); Opossum, Turkey, Zebra finch, Chicken, Stickleback, Pufferfish (89%); Xenopus, Zebrafish (83%).

GLG1 / MG160 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Chimpanzee, Chicken, Dog, Xenopus, Guinea pig, Gorilla, Horse, Human, Monkey, Mouse, Orang-Utan, Pig, Rabbit, Rat
Conjugation Unconjugated
Immunogen GLG1 / MG160 antibody was raised against synthetic 19 amino acid peptide from internal region of human GLG1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig, Opossum, Guinea pig, Turkey, Zebra finch, Chicken, Lizard, Xenopus (100%); Hamster (95%); Stickleback, Medaka, Pufferfish, Zebrafish (84%).

GPC4 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Gibbon, Gorilla, Hamster, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GPC4 / Glypican 4 antibody was raised against synthetic 16 amino acid peptide from internal region of human GPC4 / Glypican 4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Rat, Bat, Hamster (100%); Marmoset, Dog, Elephant, Panda, Rabbit (94%); Bovine, Horse, Pig (88%).

GPR55 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen GPR55 antibody was raised against synthetic 17 amino acid peptide from 3rd extracellular domain of human GPR55. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey, Marmoset, Hamster, Bovine, Dog, Horse (94%); Elephant, Panda, Bat (88%); Rabbit (82%).

GPR61 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Gorilla, Horse, Human, Monkey, Mouse, Pig, Rat
Conjugation Unconjugated
Immunogen GPR61 antibody was raised against synthetic 18 amino acid peptide from 2nd cytoplasmic domain of human GPR61. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bat, Bovine, Elephant, Panda, Horse, Pig, Opossum (100%); Hamster (94%); Lizard, Pufferfish, Zebrafish (89%); Xenopus (83%).

GPR88 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla
Conjugation Unconjugated
Immunogen GPR88 antibody was raised against synthetic 18 amino acid peptide from 1st cytoplasmic domain of human GPR88. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Mouse, Rat, Bovine, Hamster, Panda, Rabbit, Opossum (100%); Turkey, Chicken (89%); Lizard, Xenopus (83%).

KCNMA1 / BK Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Pig, Horse
Conjugation Unconjugated
Immunogen KCNMA1 / BK antibody was raised against synthetic 15 amino acid peptide from internal region of human KCNMA1. Percent identity with other species by BLAST analysis: Human, Monkey, Mouse, Rat, Hamster, Bovine, Horse, Rabbit, Pig, Turkey, Chicken, Xenopus, Seabass, Stickleback, Pufferfish, Zebrafish (100%).

GPR23 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gorilla, Human
Conjugation Unconjugated
Immunogen LPAR4 / GPR23 antibody was raised against synthetic 17 amino acid peptide from C-terminal cytoplasmic domain of human LPAR4 / GPR23. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Marmoset, Mouse, Rat, Bat, Hamster, Rabbit, Pig (94%); Monkey, Bovine, Panda, Horse (88%); Dog, Elephant (82%).

MFI2 / Melanotransferrin Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Dog, Gorilla, Horse, Human, Monkey, Mouse, Rabbit
Conjugation Unconjugated
Immunogen MFI2 / p97 / Melanotransferrin antibody was raised against synthetic 15 amino acid peptide from N-terminus of human MFI2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset, Mouse, Dog, Elephant, Panda, Horse, Rabbit (100%); Bovine, Hamster, Pig (93%); Rat, Turkey, Chicken, Platypus (87%).

NPSR1 / NPSR Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Hamster, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen NPSR1 / NPSR / GPR154 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human NPSR1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster (100%); Elephant, Panda, Bovine, Bat, Pig, Turkey, Chicken (94%); Dog, Opossum, Lizard (89%); Horse, Platypus (83%).

NR2E3 / PNR Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gorilla, Human
Conjugation Unconjugated
Immunogen NR2E3 / PNR antibody was raised against synthetic 18 amino acid peptide from near N-terminus of human NR2E3. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon, Marmoset, Mouse, Hamster (94%); Bovine (89%); Elephant, Pig (83%).

NR2E3 / PNR Rabbit Polyclonal (Ligand-binding Domain) Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Chimpanzee, Gorilla, Hamster, Horse, Human, Mouse, Pig
Conjugation Unconjugated
Immunogen NR2E3 / PNR antibody was raised against synthetic 19 amino acid peptide from ligand-binding domain of human NR2E3. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Mouse, Hamster, Elephant, Panda, Bovine, Bat, Horse, Pig (100%); Marmoset (95%).

Phosphodiesterase 6a / PDE6A Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Hamster, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen PDE6A antibody was raised against synthetic 18 amino acid peptide from N-terminus of human PDE6A / PDE6 Alpha. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster (100%); Dog, Panda, Rabbit (94%); Bovine, Bat, Elephant (89%); Horse, Opossum (83%).

PTPRM Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Hamster, Horse, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen PTPRM / PTP Mu antibody was raised against synthetic 18 amino acid peptide from internal region of human PTPRM. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Mouse, Rat, Hamster, Panda, Horse, Rabbit, Opossum (100%); Marmoset, Bovine, Bat (94%).

SLC7A2 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Chimpanzee, Gorilla, Human, Mouse, Pig, Rabbit, Rat
Conjugation Unconjugated
Immunogen SLC7A2 antibody was raised against synthetic 12 amino acid peptide from internal region of human SLC7A2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey, Mouse, Rat, Rabbit, Pig (100%); Orangutan, Gibbon, Galago, Marmoset, Hamster, Bovine, Bat, Horse (92%); Panda, Dog, Platypus (83%).

T1R1 / TAS1R1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Dog, Gorilla, Horse, Human, Pig
Conjugation Unconjugated
Immunogen Synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human TAS1R1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Bovine, Cat, Dog, Elephant, Panda, Horse, Pig (100%); Marmoset, Mouse, Rat, Hamster, Rabbit