Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-FKBP5 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FKBP5 antibody: synthetic peptide directed towards the C terminal of human FKBP5. Synthetic peptide located within the following region: CYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFE

Carrier-free (BSA/glycerol-free) FKBP5 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-FKBP5 (FKBP51) mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-FKBP5 (FKBP51) mouse monoclonal antibody, clone OTI3E9 (formerly 3E9), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Anti-FKBP5 (FKBP51) mouse monoclonal antibody, clone OTI3E9 (formerly 3E9), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-FKBP5 (FKBP51) mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated