Primary Antibodies

Jump to Filters
View as table Download
FOXC1 (+FOXC2) Rabbit Polyclonal Antibody
AP20435PU-N

USD 407.00

2 Weeks

FOXC1 (+FOXC2) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 100-150 of Human FoxC1.
FOXC1 Rabbit Polyclonal Antibody
TA335192

USD 375.00

5 Days

Rabbit Polyclonal Anti-FOXC1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXC1 antibody: synthetic peptide directed towards the N terminal of human FOXC1. Synthetic peptide located within the following region: GGYTAMPAPMSVYSHPAHAEQYPGGMARAYGPYTPQPQPKDMVKPPYSYI