Primary Antibodies

Jump to Filters
View as table Download
KCNK9 Rabbit Polyclonal Antibody
TA338578

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCNK9 Antibody

Applications IHC, WB
Reactivities Human
Immunogen The immunogen for anti-KCNK9 antibody: synthetic peptide directed towards the N terminal of human KCNK9. Synthetic peptide located within the following region: REEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFY
KCNK9 Rabbit Polyclonal Antibody
TA351318

USD 345.00

In Stock

Rabbit Polyclonal Anti-KCNK9 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNK9