KCNK9 Rabbit Polyclonal Antibody

CAT#: TA338578

Rabbit Polyclonal Anti-KCNK9 Antibody

Product Images

WB Suggested Anti-KCNK9 Antibody Titration: 1 ug/ml; Positive Control: HepG2 cell lysate

• 

  Host: Rabbit; Target Name: KCNK9; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0 ug/ml

• 

  Immunohistochemistry with Human Prostate lysate tissue at an antibody concentration of 5.0 ug/ml using anti-KCNK9 antibody

• 

  Immunohistochemistry with prostate cell lysate tissue at an antibody concentration of 5.0 ug/ml using anti-KCNK9 antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC, IF
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KCNK9 antibody: synthetic peptide directed towards the N terminal of human KCNK9. Synthetic peptide located within the following region: REEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Database Link:
  NP_057685
  Entrez Gene 51305 Human
• Background: This gene encodes a protein that contains multiple transmembrane regions and two pore-forming P domains and functions as a pH-dependent potassium channel. Amplification and overexpression of this gene have been observed in several types of human carcinomas. This gene is imprinted in the brain, with preferential expression from the maternal allele. A mutation in this gene was associated with Birk-Barel mental retardation dysmorphism syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013]
• Synonyms: K2p9.1; KT3.2; TASK-3; TASK3
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Mouse: 79%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Potassium, Transmembrane