Primary Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 12 of 12 results

(reset)

CYP11B1 Rabbit Polyclonal Antibody

TA342857

USD 375.00

5 Days

Rabbit Polyclonal Anti-CYP11B1 Antibody

Applications	IHC, WB
Reactivities	Human, Monkey
Conjugation	Unconjugated
Immunogen	The immunogen for anti-CYP11B1 antibody: synthetic peptide directed towards the C terminal of human CYP11B1. Synthetic peptide located within the following region: ARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGL

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

CYP21A2 Rabbit Polyclonal Antibody

TA342859

USD 375.00

5 Days

Rabbit Polyclonal Anti-CYP21A2 Antibody

Applications	IHC, WB
Reactivities	Human, Monkey
Conjugation	Unconjugated
Immunogen	The immunogen for anti-CYP21A2 antibody: synthetic peptide directed towards the C terminal of human CYP21A2. Synthetic peptide located within the following region: IQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATIAEVLRLRPVVPLA

1 / 3

2 / 3

3 / 3

Previous Next

Cytochrome P450 2A6 (CYP2A6) Mouse Monoclonal Antibody [Clone ID: OTI1D2]

CF503857

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CYP2A6 mouse monoclonal antibody, clone OTI1D2 (formerly 1D2)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Cytochrome P450 2B6 (CYP2B6) Mouse Monoclonal Antibody [Clone ID: OTI3D5]

CF504328

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CYP2B6 mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Cytochrome P450 2A6 (CYP2A6) Mouse Monoclonal Antibody [Clone ID: OTI1D2]

TA503857

USD 379.00

In Stock

CYP2A6 (Cytochrome P450 2A6) mouse monoclonal antibody, clone OTI1D2 (formerly 1D2)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Cytochrome P450 2A6 (CYP2A6) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D2]

TA503857AM

USD 420.00

5 Days

CYP2A6 mouse monoclonal antibody,clone 1D2, Biotinylated

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Biotin

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Cytochrome P450 2A6 (CYP2A6) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D2]

TA503857BM

USD 420.00

5 Days

CYP2A6 mouse monoclonal antibody,clone 1D2, HRP conjugated

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	HRP

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Cytochrome P450 2A6 (CYP2A6) Mouse Monoclonal Antibody [Clone ID: OTI1D2]

TA503857S

USD 159.00

In Stock

CYP2A6 (Cytochrome P450 2A6) mouse monoclonal antibody, clone OTI1D2 (formerly 1D2)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Cytochrome P450 2B6 (CYP2B6) Mouse Monoclonal Antibody [Clone ID: OTI3D5]

TA504328

USD 379.00

In Stock

CYP2B6 (Cytochrome P450 2B6) mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Cytochrome P450 2B6 (CYP2B6) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D5]

TA504328AM

USD 420.00

4 Weeks

CYP2B6 (Cytochrome P450 2B6) mouse monoclonal antibody, clone OTI3D5 (formerly 3D5), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Biotin

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Cytochrome P450 2B6 (CYP2B6) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D5]

TA504328BM

USD 420.00

4 Weeks

CYP2B6 (Cytochrome P450 2B6) mouse monoclonal antibody, clone OTI3D5 (formerly 3D5), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	HRP

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Cytochrome P450 2B6 (CYP2B6) Mouse Monoclonal Antibody [Clone ID: OTI3D5]

TA504328S

USD 159.00

In Stock

CYP2B6 (Cytochrome P450 2B6) mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

1 - 12 of 12 results