Primary Antibodies

Jump to Filters
View as table Download
FUBP1 Rabbit Polyclonal Antibody
TA339086

USD 375.00

5 Days

Rabbit Polyclonal Anti-FUBP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FUBP1 antibody: synthetic peptide directed towards the middle region of human FUBP1. Synthetic peptide located within the following region: YYAHYYQQQAQPPPAAPAGAPTTTQTNGQGDQQNPAPAGQVDYTKAWEEY
FUBP1 Goat Polyclonal Antibody
TA311561

USD 375.00

5 Days

Goat Anti-Fubp1 (mouse, aa160-174) Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DQIVEKGRPAPGFHH, from the internal region of the protein sequence according to NP_476513.2.