FUBP1 Rabbit Polyclonal Antibody

CAT#: TA339086

Rabbit Polyclonal Anti-FUBP1 Antibody

Product Images

WB Suggested Anti-FUBP1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: HepG2 cell lysate FUBP1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

• 

  Immunohistochemistry with Human Breast tissue at an antibody concentration of 5.0 ug/ml using anti-FUBP1 antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FUBP1 antibody: synthetic peptide directed towards the middle region of human FUBP1. Synthetic peptide located within the following region: YYAHYYQQQAQPPPAAPAGAPTTTQTNGQGDQQNPAPAGQVDYTKAWEEY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 67 kDa
• Gene Name: far upstream element binding protein 1
• Database Link:
  NP_003893
  Entrez Gene 8880 Human
  UniProt ID Q96AE4
• Background: This gene encodes a ssDNA binding protein that activates the far upstream element (FUSE) of c-myc and stimulates expression of c-myc in undifferentiated cells. Regulation of FUSE by FUBP occurs through single-strand binding of FUBP to the non-coding strand. This protein has been shown to function as an ATP-dependent DNA helicase. [provided by RefSeq, Jul 2008]
• Synonyms: FBP; FUBP; hDH V
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%; Mouse: 92%

Reference Data

• Protein Families: Stem cell - Pluripotency, Transcription Factors