Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-PON3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PON3 antibody: synthetic peptide directed towards the middle region of human PON3. Synthetic peptide located within the following region: PMKLLNYNPEDPPGSEVLRIQNVLSEKPRVSTVYANNGSVLQGTSVASVY

Carrier-free (BSA/glycerol-free) PON3 mouse monoclonal antibody, clone OTI1F12 (formerly 1F12)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PON3 mouse monoclonal antibody, clone OTI5C3 (formerly 5C3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PON3 mouse monoclonal antibody,clone OTI1A5

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PON3 mouse monoclonal antibody,clone OTI1B12

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

PON3 mouse monoclonal antibody, clone OTI1F12 (formerly 1F12)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

PON3 mouse monoclonal antibody, clone OTI1F12 (formerly 1F12)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

PON3 mouse monoclonal antibody, clone OTI5C3 (formerly 5C3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

PON3 mouse monoclonal antibody, clone OTI5C3 (formerly 5C3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

PON3 mouse monoclonal antibody,clone OTI1A5

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

PON3 mouse monoclonal antibody,clone OTI1A5

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

PON3 mouse monoclonal antibody,clone OTI1B12

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

PON3 mouse monoclonal antibody,clone OTI1B12

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated