Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Goat Polyclonal Anti-Cathepsin D Antibody
| Applications | IF, IHC, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli. |
Goat Polyclonal Anti-Cathepsin D Antibody
| Applications | IF, IHC, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli. |
Goat Polyclonal Anti-Rab27 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 120 aa to the C-terminus of mouse Rab27a and rab27b produced in E. coli. |
Goat Polyclonal Anti-Rab11 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat, Mousse, Canine, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptides derived from within residues 110 aa to the C-terminus of mouse Rab11a, Rab11b and Rab11c (Rab25) produced in E. coli. |
Goat Polyclonal Anti-Rab11 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat, Mousse, Canine, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptides derived from within residues 110 aa to the C-terminus of mouse Rab11a, Rab11b and Rab11c (Rab25) produced in E. coli. |
Goat Polyclonal Anti-Rab27 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 120 aa to the C-terminus of mouse Rab27a and rab27b produced in E. coli. |
USD 360.00
2 Weeks
Rabbit Polyclonal Anti-NUCB2 Antibody
| Applications | IHC, WB |
| Reactivities | Canine, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NUCB2 antibody: synthetic peptide directed towards the middle region of human NUCB2. Synthetic peptide located within the following region: MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE |
Active filters
Reactivities
- Canine
Applications
- IHC
Isotypes
- IgG
Filter by
Category
Target Symbol
Antibody Hosts
Clonalities
Conjugates
Families
Pathways
- Endocytosis (5)
- Lysosome (2)
- Adherens junction (1)
- Antigen processing and presentation (1)
- Epithelial cell signaling in Helicobacter pylori infection (1)
- Gap junction (1)
- MAPK signaling pathway (1)
- Neuroactive ligand-receptor interaction (1)
- Prion diseases (1)
- Spliceosome (1)
- Tight junction (1)
- Vibrio cholerae infection (1)