Nucleobindin 2 (NUCB2) Rabbit Polyclonal Antibody

CAT#: TA341643

Rabbit Polyclonal Anti-NUCB2 Antibody

Product Images

Lanes: Lane 1: 50ug HEK293 lysate; Lane 2: 50ug MDCK lysate; Lane 3: 50ug NMuMG lysate; Lane 4: 50ug MDAMB231 lysate; Primary Antibody Dilution: ; 1:1000; Secondary Antibody: ; Goat anti-rabbit-Alexa Fluor 680; Secondary Antibody Dilution: ; 1:10,000; Gen

• 

  Human Intestine

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Canine, Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NUCB2 antibody: synthetic peptide directed towards the middle region of human NUCB2. Synthetic peptide located within the following region: MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: nucleobindin 2
• Database Link:
  NP_005004
  Entrez Gene 53322 MouseEntrez Gene 4925 Human
  UniProt ID P80303
• Background: This gene encodes a protein with a suggested role in calcium level maintenance, eating regulation inThe hypothalamus, and release of tumor necrosis factor from vascular endothelial cells.This protein binds calcium and has EF-folding domains. [provided by RefSeq, Oct 2011]
• Synonyms: HEL-S-109; NEFA
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Yeast: 91%; Guinea pig: 86%

Reference Data

• Protein Families: Secreted Protein, Transmembrane