Primary Antibodies

Jump to Filters
View as table Download
Oct6 (POU3F1) Rabbit Polyclonal Antibody
TA332119

USD 310.00

5 Days

Rabbit Polyclonal Anti-POU3F1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-POU3F1 Antibody: synthetic peptide directed towards the N terminal of human POU3F1. Synthetic peptide located within the following region: YLPRGPGGGAGGTGPLMHPDAAAAAAAAAERLHAGAAYREVQKLMHHEWL
Oct6 (POU3F1) Rabbit Polyclonal Antibody
TA322970

USD 345.00

4 Weeks

Anti-POU3F1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to N terminal 13 amino acids of human POU class 3 homeobox 1