Oct6 (POU3F1) Rabbit Polyclonal Antibody

CAT#: TA332119

Rabbit Polyclonal Anti-POU3F1 Antibody

Product Images

WB Suggested Anti-POU3F1 Antibody Titration: 2.5ug/ml; Positive Control: Jurkat cell lysate

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-POU3F1 Antibody: synthetic peptide directed towards the N terminal of human POU3F1. Synthetic peptide located within the following region: YLPRGPGGGAGGTGPLMHPDAAAAAAAAAERLHAGAAYREVQKLMHHEWL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: POU class 3 homeobox 1
• Database Link:
  NP_002690
  Entrez Gene 5453 Human
  UniProt ID Q03052
• Background: POU3F1 is a member of the POU domain family of proteins, and regulates events during neurogenesis and myelination.
• Synonyms: OCT6; OTF6; SCIP
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transcription Factors