Primary Antibodies

Jump to Filters
View as table Download
TRP1 (TYRP1) Rabbit Polyclonal Antibody
TA371961

USD 380.00

4 Weeks

TYRP1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human TYRP1
TRP1 (TYRP1) Rabbit Polyclonal Antibody
TA335249

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-TYRP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TYRP1 antibody: synthetic peptide directed towards the middle region of human TYRP1. Synthetic peptide located within the following region: NDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWP