Germany
Japan
United Kingdom
China
TRP1 (TYRP1) Rabbit Polyclonal Antibody
Product Images
Other products for "TYRP1"
Specifications
| Product Data | |
| Applications | IHC, WB |
| Recommended Dilution | WB, IHC |
| Reactivities | Human, Mouse |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-TYRP1 antibody: synthetic peptide directed towards the middle region of human TYRP1. Synthetic peptide located within the following region: NDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWP |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 61 kDa |
| Gene Name | tyrosinase related protein 1 |
| Database Link | |
| Background | TYRP1 catalyses the oxidation of 5,6-dihydroxyindole-2-carboxylic acid (DHICA) into indole-5,6-quinone-2-carboxylic acid. It may regulate or influence the type of melanin synthesized. |
| Synonyms | b-PROTEIN; CAS2; CATB; GP75; OCA3; TRP; TRP1; TYRP |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Zebrafish: 86% |
| Reference Data | |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Melanogenesis, Metabolic pathways, Tyrosine metabolism |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.