Primary Antibodies

View as table Download

VDAC2 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human VDAC2 (NP_003366.2).

Rabbit Polyclonal Anti-VDAC2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VDAC2 antibody: synthetic peptide directed towards the N terminal of human VDAC2. Synthetic peptide located within the following region: MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGV

Anti-VDAC2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 283-294 amino acids of human voltage-dependent anion channel 2