Primary Antibodies

View as table Download

Rabbit polyclonal anti-NF-Y antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen NF-Y (A subunit specific) peptide corresponding to a region near the N-terminus of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH).

Rabbit Polyclonal anti-NFYA antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NFYA antibody: synthetic peptide directed towards the C terminal of human NFYA. Synthetic peptide located within the following region: YLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS

Rabbit Polyclonal anti-NFYA antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NFYA antibody: synthetic peptide directed towards the C terminal of human NFYA. Synthetic peptide located within the following region: YLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS