NFYA Rabbit Polyclonal Antibody

CAT#: TA329233

Rabbit Polyclonal anti-NFYA antibody

Product Images

WB Suggested Anti-NFYA Antibody Titration: 5.0-8.0ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysateNFYA is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

• 

  Human Liver

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NFYA antibody: synthetic peptide directed towards the C terminal of human NFYA. Synthetic peptide located within the following region: YLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: nuclear transcription factor Y subunit alpha
• Database Link:
  NP_002496
  Entrez Gene 4800 Human
  UniProt ID P23511
• Background: NFYA is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds to CCAAT motifs in the promoter regions in a variety of genes. Subunit A associates with a tight dimer composed of the B and C subunits, resulting in a trimer that binds to DNA with high specificity and affinity. The sequence specific interactions of the complex are made by the A subunit, suggesting a role as the regulatory subunit. In addition, there is evidence of post-transcriptional regulation in this gene product, either by protein degradation or control of translation. Further regulation is represented by alternative splicing in the glutamine-rich activation domain, with clear tissue-specific preferences for the two isoforms.
• Synonyms: CBF-A; CBF-B; HAP2; NF-YA
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Yeast: 80%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Antigen processing and presentation