Primary Antibodies

Jump to Filters
View as table Download
TFIIE beta (GTF2E2) Rabbit Polyclonal Antibody
TA313982

USD 345.00

In Stock

Rabbit polyclonal anti-TF2E2 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TF2E2.
TFIIE beta (GTF2E2) Rabbit Polyclonal Antibody
TA329281

USD 375.00

5 Days

Rabbit Polyclonal anti-GTF2E2 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2E2 antibody: synthetic peptide directed towards the N terminal of human GTF2E2. Synthetic peptide located within the following region: VEHGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGVLAKIVNYMKTRHQRG