Rabbit Polyclonal Anti-CRBN Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CRBN antibody was raised against a 16 amino acid peptide near the carboxy terminus of human CRBN. |
Rabbit Polyclonal Anti-CRBN Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CRBN antibody was raised against a 16 amino acid peptide near the carboxy terminus of human CRBN. |
Rabbit polyclonal anti-NOX3 antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NOX3. |
Rabbit Polyclonal Anti-NOX3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NOX3 |
NOX3 Antibody
Applications | IHC |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the following sequence KQIAYNHPSSSIGVFFCGPKALSRTLQKMCHLYSSADPRGVHFYYNKESF |