Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-ASS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASS antibody: synthetic peptide directed towards the C terminal of human ASS. Synthetic peptide located within the following region: SVLKGQVYILGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRLKE

Rabbit Polyclonal Anti-ASS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASS antibody: synthetic peptide directed towards the N terminal of human ASS. Synthetic peptide located within the following region: YSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVF

Rabbit Polyclonal antibody to ASS1 (argininosuccinate synthetase 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 198 of ASS1 (Uniprot ID#P00966)

Carrier-free (BSA/glycerol-free) ASS1 mouse monoclonal antibody,clone OTI3D1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ASS1 mouse monoclonal antibody,clone OTI8H4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ASS1 mouse monoclonal antibody,clone OTI12G1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASS1 mouse monoclonal antibody,clone OTI3D1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASS1 mouse monoclonal antibody,clone OTI3D1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ASS1 mouse monoclonal antibody,clone OTI8H4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASS1 mouse monoclonal antibody,clone OTI8H4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ASS1 mouse monoclonal antibody,clone OTI12G1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASS1 mouse monoclonal antibody,clone OTI12G1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".