ASS1 Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human argininosuccinate synthetase 1 (ASS1), transcript variant 2
USD 823.00
Transient overexpression lysate of argininosuccinate synthetase 1 (ASS1), transcript variant 2
USD 396.00
Other products for "ASS1"
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | WB, IHC |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ASS antibody: synthetic peptide directed towards the N terminal of human ASS. Synthetic peptide located within the following region: YSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVF |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 45 kDa |
Gene Name | argininosuccinate synthase 1 |
Database Link | |
Background | ASS catalyzes the penultimate step of the arginine biosynthetic pathway.The protein encoded by this gene catalyzes the penultimate step of the arginine biosynthetic pathway. There are approximately 10 to 14 copies of this gene including the pseudogenes scattered across the human genome, among which the one located on chromosome 9 appears to be the only functional gene for argininosuccinate synthetase. Mutations in the chromosome 9 copy of ASS cause citrullinemia. Two transcript variants encoding the same protein have been found for this gene. |
Synonyms | ASS; CTLN1 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Yeast: 86%; Zebrafish: 79% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Alanine, aspartate and glutamate metabolism, Arginine and proline metabolism, Metabolic pathways |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.