Rabbit Polyclonal MDA5 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | MDA5 antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human MDA5. |
Rabbit Polyclonal MDA5 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | MDA5 antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human MDA5. |
Rabbit Polyclonal MDA5 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | MDA5 antibody was raised against a 16 amino acid peptide from near the center of human MDA5. |
Goat Polyclonal Antibody against IFIH1 (MDA5)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence SNGYSTDENFRYL-C, from the N Terminus of the protein sequence according to NP_071451.2. |
Rabbit Polyclonal Anti-IFIH1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IFIH1 antibody: synthetic peptide directed towards the middle region of human IFIH1. Synthetic peptide located within the following region: QINDTIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGDDEYCDGDEDED |
IFIH1 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-205 of human IFIH1 (NP_071451.2). |
Modifications | Unmodified |