Primary Antibodies

View as table Download

Rabbit polyclonal anti-EGR-1 antibody

Applications IHC, WB
Reactivities Chimpanzee, Human, Mouse
Conjugation Unconjugated
Immunogen This affinity-purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 94-108 (eqpyehltaesfpdi) of Human EGR-1.

Rabbit Polyclonal Anti-Egr1 Antibody

Applications IHC, WB
Reactivities Mouse, Xenopus
Conjugation Unconjugated
Immunogen The immunogen for anti-Egr1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PATTSFPSPVPTSYSSPGSSTYPSPAHSGFPSPSVATTFASVPPAFPTQV

Rabbit Polyclonal Anti-EGR1 Antibody

Applications IHC, WB
Reactivities Mouse, Xenopus
Conjugation Unconjugated
Immunogen The immunogen for anti-EGR1 antibody: synthetic peptide directed towards the N terminal of mouse EGR1. Synthetic peptide located within the following region: GTPEGSGGNSSSSTSSGGGGGGGSNSGSSAFNPQGEPSEQPYEHLTTESF

EGR1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human EGR1 (NP_001955.1).
Modifications Unmodified