EGR1 Rabbit Polyclonal Antibody

CAT#: TA341754

Rabbit Polyclonal Anti-Egr1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "EGR1"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution IHC, WB
Reactivities Mouse, Xenopus
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Egr1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PATTSFPSPVPTSYSSPGSSTYPSPAHSGFPSPSVATTFASVPPAFPTQV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 56 kDa
Gene Name early growth response 1
Background Transcriptional regulator. Recognizes and binds toThe DNA sequence 5'-CGCCCCCGC-3'(EGR-site). ActivatesThe transcription of target genes whose products are required for mitogenesis and differentiation.
Synonyms AT225; G0S30; KROX-24; NGFI-A; TIS8; ZIF-268; ZNF225
Note Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Human: 93%; Rabbit: 93%; Guinea pig: 93%; Sheep: 92%; Bovine: 92%
Reference Data
Protein Families Druggable Genome
Protein Pathways Prion diseases

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.