Germany
Japan
United Kingdom
China
EGR1 Rabbit Polyclonal Antibody
Product Images
Other products for "EGR1"
Specifications
| Product Data | |
| Applications | IHC, WB |
| Recommended Dilution | IHC, WB |
| Reactivities | Mouse, Xenopus |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-Egr1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PATTSFPSPVPTSYSSPGSSTYPSPAHSGFPSPSVATTFASVPPAFPTQV |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 56 kDa |
| Gene Name | early growth response 1 |
| Database Link | |
| Background | Transcriptional regulator. Recognizes and binds toThe DNA sequence 5'-CGCCCCCGC-3'(EGR-site). ActivatesThe transcription of target genes whose products are required for mitogenesis and differentiation. |
| Synonyms | AT225; G0S30; KROX-24; NGFI-A; TIS8; ZIF-268; ZNF225 |
| Note | Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Human: 93%; Rabbit: 93%; Guinea pig: 93%; Sheep: 92%; Bovine: 92% |
| Reference Data | |
| Protein Families | Druggable Genome |
| Protein Pathways | Prion diseases |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.