Primary Antibodies

View as table Download

ACTN3 (N-term) rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen ACTN3 antibody was raised against synthetic peptide - KLH conjugated

Rabbit Polyclonal Anti-ACTN3 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTN3 antibody: synthetic peptide directed towards the N terminal of human ACTN3. Synthetic peptide located within the following region: VQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKY

ACTN3 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 408-437 amino acids from the Central region of human ACTN3

ACTN3 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 580-630 of human ACTN3 (NP_001095.2).
Modifications Unmodified