Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-APCS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APCS antibody: synthetic peptide directed towards the N terminal of human APCS. Synthetic peptide located within the following region: NFTLCFRAYSDLSRAYSLFSYNTQGRDNELLVYKERVGEYSLYIGRHKVT

Serum Amyloid P (APCS) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 151-178 amino acids from the C-terminal region of Human APCS

Rabbit anti-APCS Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human APCS