Rabbit Polyclonal Anti-RARRES3 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human RARRES3 |
Rabbit Polyclonal Anti-RARRES3 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human RARRES3 |
Rabbit Polyclonal Anti-RARRES3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RARRES3 antibody: synthetic peptide directed towards the middle region of human RARRES3. Synthetic peptide located within the following region: FSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMV |