PRMT5 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human PRMT5 |
PRMT5 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human PRMT5 |
Rabbit Polyclonal Anti-PRMT5 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRMT5 antibody: synthetic peptide directed towards the N terminal of human PRMT5. Synthetic peptide located within the following region: FDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLS |
Carrier-free (BSA/glycerol-free) PRMT5 mouse monoclonal antibody, clone OTI4G7 (formerly 4G7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PRMT5 mouse monoclonal antibody, clone OTI2C12 (formerly 2C12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PRMT5 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-PRMT5 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide peptide corresponding to a region derived from 622-637 amino acids of human protein arginine methyltransferase 5 |
PRMT5 mouse monoclonal antibody, clone OTI4G7 (formerly 4G7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PRMT5 mouse monoclonal antibody, clone OTI4G7 (formerly 4G7), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PRMT5 mouse monoclonal antibody, clone OTI4G7 (formerly 4G7), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PRMT5 mouse monoclonal antibody, clone OTI4G7 (formerly 4G7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PRMT5 mouse monoclonal antibody, clone OTI2C12 (formerly 2C12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PRMT5 mouse monoclonal antibody, clone OTI2C12 (formerly 2C12), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PRMT5 mouse monoclonal antibody, clone OTI2C12 (formerly 2C12), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PRMT5 mouse monoclonal antibody, clone OTI2C12 (formerly 2C12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PRMT5 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PRMT5 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3), Biotinylated
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PRMT5 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3), HRP conjugated
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PRMT5 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |