Primary Antibodies

Jump to Filters
View as table Download
RACK1 Rabbit Polyclonal Antibody
TA345944

USD 475.00

5 Days

Rabbit Polyclonal Anti-GNB2L1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNB2L1 antibody: synthetic peptide directed towards the N terminal of human GNB2L1. Synthetic peptide located within the following region: ISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQI
RACK1 Rabbit Polyclonal Antibody
TA302104

USD 450.00

In Stock

Rabbit Polyclonal Antibody against GNB2L1 (N-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This GNB2L1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 29-58 amino acids from the N-terminal region of human GNB2L1.
RACK1 Mouse Monoclonal Antibody [Clone ID: OTI2D8]
CF502717

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GNB2L1 mouse monoclonal antibody, clone OTI2D8 (formerly 2D8)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
RACK1 Rabbit Polyclonal Antibody
TA350321

USD 345.00

In Stock

Rabbit Polyclonal Anti-GNB2L1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GNB2L1
RACK1 Rabbit Monoclonal Antibody [Clone ID: R02-1K6]
TA385116

USD 380.00

4 Weeks

RACK1 Rabbit monoclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
RACK1 Mouse Monoclonal Antibody [Clone ID: OTI2D8]
TA502717

USD 379.00

In Stock

GNB2L1 (RACK1) mouse monoclonal antibody, clone OTI2D8 (formerly 2D8)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
RACK1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D8]
TA502717AM

USD 420.00

4 Weeks

GNB2L1 (RACK1) mouse monoclonal antibody, clone OTI2D8 (formerly 2D8), Biotinylated

Applications FC, IHC, WB
Reactivities Human
Conjugation Biotin
RACK1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D8]
TA502717BM

USD 420.00

4 Weeks

GNB2L1 (RACK1) mouse monoclonal antibody, clone OTI2D8 (formerly 2D8), HRP conjugated

Applications FC, IHC, WB
Reactivities Human
Conjugation HRP
RACK1 Mouse Monoclonal Antibody [Clone ID: OTI2D8]
TA502717S

USD 159.00

2 Days

GNB2L1 (RACK1) mouse monoclonal antibody, clone OTI2D8 (formerly 2D8)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated