Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-SERPINC1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SERPINC1 antibody: synthetic peptide directed towards the middle region of human SERPINC1. Synthetic peptide located within the following region: ISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQD

Rabbit polyclonal SERPINC1 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This SERPINC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 364-393 amino acids from the C-terminal region of human SERPINC1.

Antithrombin III (SERPINC1) goat polyclonal antibody, Serum

Applications ELISA, ID, IHC
Reactivities Human
Immunogen Antithrombin III isolated and highly purified from pooled plasma.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Anti-SERPINC1 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 15-259 amino acids of human serpin peptidase inhibitor, clade C (antithrombin), member 1

Anti-SERPINC1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 15-259 amino acids of human serpin peptidase inhibitor, clade C (antithrombin), member 1