Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-ARF1 Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ARF1 antibody: synthetic peptide directed towards the middle region of human ARF1. Synthetic peptide located within the following region: MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA

Rabbit anti-GNAS Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GNAS

Carrier-free (BSA/glycerol-free) SHC1 mouse monoclonal antibody, clone OTI3A1 (formerly 3A1)

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-SHC1 (SHC) mouse monoclonal antibody, clone OTI3A1 (formerly 3A1)

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-SHC1 (SHC) mouse monoclonal antibody, clone OTI3A1 (formerly 3A1), Biotinylated

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Anti-SHC1 (SHC) mouse monoclonal antibody, clone OTI3A1 (formerly 3A1), HRP conjugated

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-SHC1 (SHC) mouse monoclonal antibody, clone OTI3A1 (formerly 3A1)

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated