ARF1 Rabbit Polyclonal Antibody

CAT#: TA346559

Rabbit Polyclonal Anti-ARF1 Antibody

Product Images

ARF1 antibody - middle region validated by WB using Fetal lung Lysate at 0.2-1 ug/ml.

• 

  Sample Type: 1. Human NT-2 cells (60ug)2. mouse brain extracts (80ug); Primary antibody dilution: 2 ug/ml; Secondary antibody: IRDye 800CW goat anti-rabbit from Li-COR Bioscience; Secondary antibody dilution: 1: 20, 000;

• 

  Application: IHC; Species+tissue/cell type: Mouse brain stem cells; Primary antibody dilution: 1: 500; Secondary antibody: Goat anti-rabbit Alexa-Fluor 594; Secondary antibody dilution: 1: 1000

• 

  Sample Type: Mouse Brain lysate

• 

  Amount and Sample Type: 500 ug rat brain homogenate; Amount of IP Antibody: 6 ug; Primary Antibody: ARF1; Primary Antibody Dilution: 1: 500; Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594; Secondary Antibody Dilution: 1: 5000; Gene Name: ARF1;

Show all 5 images

Specifications

Product Data

• Applications: IHC, IP, WB
• Recommended Dilution: WB, IHC, IP
• Reactivities: Human, Mouse, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ARF1 antibody: synthetic peptide directed towards the middle region of human ARF1. Synthetic peptide located within the following region: MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 21 kDa
• Gene Name: ADP ribosylation factor 1
• Database Link:
  NP_001649
  Entrez Gene 11840 MouseEntrez Gene 64310 RatEntrez Gene 375 Human
  UniProt ID P84077
• Background: ADP-ribosylation factor 1 (ARF1) is a member of the human ARF gene family. The family members encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking as activators of phospholipase D. The gene products, including 6 ARF proteins and 11 ARF-like proteins, constitute a family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2 and ARF3), class II (ARF4 and ARF5) and class III (ARF6), and members of each class share a common gene organization. The ARF1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
• Synonyms: ADP-ribosylation factor 1; OTTHUMP00000035715
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Pathways: Vibrio cholerae infection