ARF1 (NM_001658) Human Recombinant Protein
CAT#: TP302141
Recombinant protein of human ADP-ribosylation factor 1 (ARF1), transcript variant 4
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202141 protein sequence
Red=Cloning site Green=Tags(s) MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGG QDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEIT DKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001649 |
Locus ID | 375 |
UniProt ID | P84077, A0A024R3Q0 |
Cytogenetics | 1q42.13 |
Refseq Size | 1901 |
Refseq ORF | 543 |
Synonyms | PVNH8 |
Summary | ADP-ribosylation factor 1 (ARF1) is a member of the human ARF gene family. The family members encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking as activators of phospholipase D. The gene products, including 6 ARF proteins and 11 ARF-like proteins, constitute a family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2 and ARF3), class II (ARF4 and ARF5) and class III (ARF6), and members of each class share a common gene organization. The ARF1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Pathways | Vibrio cholerae infection |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419819 | ARF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC422625 | ARF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC422626 | ARF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC422627 | ARF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC425448 | ARF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC425449 | ARF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY419819 | Transient overexpression lysate of ADP-ribosylation factor 1 (ARF1), transcript variant 4 |
USD 325.00 |
|
LY422625 | Transient overexpression lysate of ADP-ribosylation factor 1 (ARF1), transcript variant 3 |
USD 325.00 |
|
LY422626 | Transient overexpression lysate of ADP-ribosylation factor 1 (ARF1), transcript variant 1 |
USD 325.00 |
|
LY422627 | Transient overexpression lysate of ADP-ribosylation factor 1 (ARF1), transcript variant 2 |
USD 325.00 |
|
LY425448 | Transient overexpression lysate of ADP-ribosylation factor 1 (ARF1), transcript variant 1 |
USD 325.00 |
|
LY425449 | Transient overexpression lysate of ADP-ribosylation factor 1 (ARF1), transcript variant 2 |
USD 325.00 |
|
PH301240 | ARF1 MS Standard C13 and N15-labeled recombinant protein (NP_001019398) |
USD 2,055.00 |
|
PH302141 | ARF1 MS Standard C13 and N15-labeled recombinant protein (NP_001649) |
USD 2,055.00 |
|
PH324474 | ARF1 MS Standard C13 and N15-labeled recombinant protein (NP_001019397) |
USD 2,055.00 |
|
TP301240 | Recombinant protein of human ADP-ribosylation factor 1 (ARF1), transcript variant 1 |
USD 823.00 |
|
TP324474 | Recombinant protein of human ADP-ribosylation factor 1 (ARF1), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review