ARF1 (NM_001024226) Human Mass Spec Standard

CAT#: PH324474

ARF1 MS Standard C13 and N15-labeled recombinant protein (NP_001019397)

Product Images

Coomassie blue staining of purified ARF1 protein (Cat# TP324474). The protein was produced from HEK293T cells transfected with ARF1 cDNA clone (Cat# RC224474) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC224474
• Predicted MW: 20.7 kDa
• Protein Sequence:
  Sequence Link

  >RC224474 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGG
  QDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEIT
  DKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001019397
• RefSeq Size: 1986
• RefSeq ORF: 543
• Synonyms: PVNH8
• Locus ID: 375
• UniProt ID: P84077, A0A024R3Q0
• Cytogenetics: 1q42.13
• Summary: 'ADP-ribosylation factor 1 (ARF1) is a member of the human ARF gene family. The family members encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking as activators of phospholipase D. The gene products, including 6 ARF proteins and 11 ARF-like proteins, constitute a family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2 and ARF3), class II (ARF4 and ARF5) and class III (ARF6), and members of each class share a common gene organization. The ARF1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]'
• Protein Pathways: Vibrio cholerae infection