Primary Antibodies

Jump to Filters
View as table Download
Adiponectin Receptor 2 (ADIPOR2) Rabbit Polyclonal Antibody
TA343073

USD 375.00

5 Days

Rabbit Polyclonal Anti-ADIPOR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADIPOR2 antibody: synthetic peptide directed towards the N terminal of human ADIPOR2. Synthetic peptide located within the following region: ASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCK
Adiponectin Receptor 2 (ADIPOR2) Rabbit Polyclonal Antibody
TA373305

USD 275.00

3 Weeks

ADIPOR2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human ADIPOR2 (NP_078827.2).
Modifications Unmodified