Adiponectin Receptor 2 (ADIPOR2) Rabbit Polyclonal Antibody

CAT#: TA343073

Rabbit Polyclonal Anti-ADIPOR2 Antibody

Product Images

WB Suggested Anti-ADIPOR2 Antibody; Titration: 1.0 ug/ml; Positive Control: MDA-MB-435S Whole Cell ADIPOR2 is supported by BioGPS gene expression data to be expressed in MDA-MB435

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ADIPOR2 antibody: synthetic peptide directed towards the N terminal of human ADIPOR2. Synthetic peptide located within the following region: ASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: adiponectin receptor 2
• Database Link:
  NP_078827
  Entrez Gene 79602 Human
  UniProt ID Q86V24
• Background: The adiponectin receptors, ADIPOR1 and ADIPOR2, serve as receptors for globular and full-length adiponectin and mediate increased AMPK and PPAR-alpha ligand activities, as well as fatty acid oxidation and glucose uptake by adiponectin.
• Synonyms: ACDCR2; PAQR2
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Dog: 92%; Pig: 82%; Guinea pig: 82%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Adipocytokine signaling pathway