Primary Antibodies

View as table Download

Goat Polyclonal Antibody against CBX1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QSQKTAHETDKSE, from the internal region of the protein sequence according to NP_006798.1.

Rabbit Polyclonal Anti-CBX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CBX1 Antibody: synthetic peptide directed towards the N terminal of human CBX1. Synthetic peptide located within the following region: MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDN

Rabbit Polyclonal Anti-CBX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CBX1 Antibody: synthetic peptide directed towards the middle region of human CBX1. Synthetic peptide located within the following region: PDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKP

CBX1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-185 of human CBX1 (NP_006798.1).
Modifications Unmodified