CBX1 Rabbit Polyclonal Antibody

CAT#: TA335672

Rabbit Polyclonal Anti-CBX1 Antibody

Product Images

WB Suggested Anti-CBX1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: OVCAR-3 cell lysateCBX1 is supported by BioGPS gene expression data to be expressed in OVCAR3

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CBX1 Antibody: synthetic peptide directed towards the N terminal of human CBX1. Synthetic peptide located within the following region: MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 21 kDa
• Gene Name: chromobox 1
• Database Link:
  NP_006798
  Entrez Gene 10951 Human
  UniProt ID P83916
• Background: CBX1 is the component of heterochromatin. CBX1 recognizes and binds histone H3 tails methylated at 'Lys-9', leading to epigenetic repression. CBX1 interaction with lamin B receptor (LBR) can contribute to the association of the heterochromatin with the in
• Synonyms: CBX; HP1-BETA; HP1Hs-beta; HP1Hsbeta; M31; MOD1; p25beta
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 93%