Germany
Japan
United Kingdom
China
Goat Polyclonal Antibody against CBX1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QSQKTAHETDKSE, from the internal region of the protein sequence according to NP_006798.1. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-CBX1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CBX1 Antibody: synthetic peptide directed towards the N terminal of human CBX1. Synthetic peptide located within the following region: MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDN |
Rabbit Polyclonal Anti-CBX1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CBX1 Antibody: synthetic peptide directed towards the middle region of human CBX1. Synthetic peptide located within the following region: PDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKP |
CBX1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-185 of human CBX1 (NP_006798.1). |
| Modifications | Unmodified |
Recombinant Anti-CBX1 (Clone RAB-C145)
| Applications | ChIP, ELISA, IF |
| Reactivities | Human |
| Conjugation | His Tag |
Recombinant Anti-CBX1 (Clone RAB-C145)
| Applications | ChIP, ELISA, IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Human Fab format, for improved compatibility with existing reagents, assays and techniques. |
Active filters
Target Symbol
- CBX1