Primary Antibodies

Jump to Filters
View as table Download
Proteinase Activated Receptor 3 (F2RL2) (N-term) Rabbit Polyclonal Antibody
AP51496PU-N

USD 450.00

2 Weeks

Proteinase Activated Receptor 3 (F2RL2) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 20-50 amino acids from the N-terminal region of human F2RL2
Proteinase Activated Receptor 3 (F2RL2) Rabbit Polyclonal Antibody
TA342829

USD 375.00

5 Days

Rabbit Polyclonal Anti-F2RL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-F2RL2 antibody: synthetic peptide directed towards the C terminal of human F2RL2. Synthetic peptide located within the following region: HANYYYNNTDGLYFIYLIALCLGSLNSCLDPFLYFLMSKTRNHSTAYLTK
Proteinase Activated Receptor 3 (F2RL2) Rabbit Polyclonal Antibody
TA351490

USD 345.00

In Stock

Rabbit Polyclonal Anti-F2RL2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human F2RL2
Proteinase Activated Receptor 3 (F2RL2) Rabbit Polyclonal Antibody
TA357658

USD 360.00

5 Days

F2RL2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PAR3