Primary Antibodies

View as table Download

Rabbit polyclonal anti-HTR4 antibody

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human HTR4.

5HT4 Receptor (HTR4) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal anti-5-HT-4 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human 5-HT-4.

5HT4 Receptor (HTR4) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human Serotonin receptor 4 (HTR4).

Rabbit Polyclonal Anti-HTR4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR4 antibody: synthetic peptide directed towards the middle region of human HTR4. Synthetic peptide located within the following region: GCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYA

Anti-5HT4 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 45-59 amino acids of Human 5-hydroxytryptamine (serotonin) receptor 4, G protein-coupled

HTR4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HTR4.
Modifications Unmodified