Primary Antibodies

View as table Download

Rabbit Polyclonal antibody to NDUFA12 (NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 145 of NDUFA12 (Uniprot ID#Q9UI09)

Rabbit Polyclonal Anti-NDUFA12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NDUFA12 antibody is: synthetic peptide directed towards the N-terminal region of Human NDUFA12. Synthetic peptide located within the following region: VLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQF

NDUFA12 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein

NDUFA12 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-145 of human NDUFA12 (NP_061326.1).
Modifications Unmodified