Primary Antibodies

Jump to Filters
View as table Download
GPR7 (NPBWR1) Rabbit Polyclonal Antibody
TA338160

USD 375.00

5 Days

Rabbit Polyclonal Anti-NPBWR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NPBWR1 antibody is: synthetic peptide directed towards the N-terminal region of Human NPBWR1. Synthetic peptide located within the following region: FSEPWPANASGPDPALSCSNASTLAPLPAPLAVAVPVVYAVICAVGLAGN
GPR7 (NPBWR1) Rabbit Polyclonal Antibody
TA379248

USD 220.00

3 Weeks

NPBWR1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human NPBWR1 (NP_005276.2).
Modifications Unmodified