Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-TNFRSF18 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNFRSF18 antibody: synthetic peptide directed towards the C terminal of human TNFRSF18. Synthetic peptide located within the following region: LRSQCMWPRETQLLLEVPPSTEDARSCQFPEEERGERSAEEKGRLGDLWV

Rabbit Polyclonal Anti-TNFRSF18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNFRSF18 antibody: synthetic peptide directed towards the C terminal of human TNFRSF18. Synthetic peptide located within the following region: LHIWQLRKTQLLLEVPPSTEDARSCQFPEEERGERSAEEKGRLGDLWV

Carrier-free (BSA/glycerol-free) TNFRSF18 mouse monoclonal antibody, clone OTI4H5 (formerly 4H5)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TNFRSF18 mouse monoclonal antibody, clone OTI1A3 (formerly 1A3)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) TNFRSF18 mouse monoclonal antibody, clone OTI3A7 (formerly 3A7)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TNFRSF18 mouse monoclonal antibody, clone OTI5G4 (formerly 5G4)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TNFRSF18 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TNFRSF18 mouse monoclonal antibody, clone OTI4A9 (formerly 4A9)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TNFRSF18 mouse monoclonal antibody, clone OTI9G8 (formerly 9G8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Recombinant Anti-GITR (Clone DTA-1)

Applications FC, IP, WB
Reactivities Mouse
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2b format, for improved compatibility with existing reagents, assays and techniques.

Recombinant Anti-GITR (Clone DTA-1)

Applications FC, IP, WB
Reactivities Mouse
Conjugation Unconjugated
Modifications This reformatted antibody was made using the variable domain sequences of the original rat IgG2b format, for improved compatibility with existing reagents, assays and techniques.

TNFRSF18 mouse monoclonal antibody, clone OTI4H5 (formerly 4H5)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

TNFRSF18 mouse monoclonal antibody, clone OTI4H5 (formerly 4H5)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

TNFRSF18 mouse monoclonal antibody, clone OTI1A3 (formerly 1A3)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

TNFRSF18 mouse monoclonal antibody, clone OTI1A3 (formerly 1A3)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

TNFRSF18 mouse monoclonal antibody, clone OTI3A7 (formerly 3A7)

Applications WB
Reactivities Human
Conjugation Unconjugated

TNFRSF18 mouse monoclonal antibody, clone OTI3A7 (formerly 3A7), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

TNFRSF18 mouse monoclonal antibody, clone OTI3A7 (formerly 3A7), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

TNFRSF18 mouse monoclonal antibody, clone OTI3A7 (formerly 3A7)

Applications WB
Reactivities Human
Conjugation Unconjugated

TNFRSF18 mouse monoclonal antibody, clone OTI5G4 (formerly 5G4)

Applications WB
Reactivities Human
Conjugation Unconjugated

TNFRSF18 mouse monoclonal antibody, clone OTI5G4 (formerly 5G4), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

TNFRSF18 mouse monoclonal antibody, clone OTI5G4 (formerly 5G4), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

TNFRSF18 mouse monoclonal antibody, clone OTI5G4 (formerly 5G4)

Applications WB
Reactivities Human
Conjugation Unconjugated

TNFRSF18 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)

Applications WB
Reactivities Human
Conjugation Unconjugated

TNFRSF18 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

TNFRSF18 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

TNFRSF18 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)

Applications WB
Reactivities Human
Conjugation Unconjugated

TNFRSF18 mouse monoclonal antibody, clone OTI4A9 (formerly 4A9)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

TNFRSF18 mouse monoclonal antibody, clone OTI4A9 (formerly 4A9)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

TNFRSF18 mouse monoclonal antibody, clone OTI9G8 (formerly 9G8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

TNFRSF18 mouse monoclonal antibody, clone OTI9G8 (formerly 9G8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated